Lineage for d2fmra_ (2fmr A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2553974Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 2553975Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 2553976Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 proteins)
    an RNA-binding domain
  6. 2553999Protein Fragile X protein, KH1 [54799] (1 species)
  7. 2554000Species Human (Homo sapiens) [TaxId:9606] [54800] (1 PDB entry)
  8. 2554001Domain d2fmra_: 2fmr A: [38808]

Details for d2fmra_

PDB Entry: 2fmr (more details)

PDB Description: kh1 from the fragile x protein fmr1, nmr, 18 structures
PDB Compounds: (A:) fmr1 protein

SCOPe Domain Sequences for d2fmra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fmra_ d.51.1.1 (A:) Fragile X protein, KH1 {Human (Homo sapiens) [TaxId: 9606]}
asrfheqfivredlmglaigthganiqqarkvpgvtaidldedtctfhiygedqdavkka
rsfle

SCOPe Domain Coordinates for d2fmra_:

Click to download the PDB-style file with coordinates for d2fmra_.
(The format of our PDB-style files is described here.)

Timeline for d2fmra_: