Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily) beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta |
Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 proteins) an RNA-binding domain |
Protein Fragile X protein, KH1 [54799] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54800] (1 PDB entry) |
Domain d2fmra_: 2fmr A: [38808] |
PDB Entry: 2fmr (more details)
SCOPe Domain Sequences for d2fmra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fmra_ d.51.1.1 (A:) Fragile X protein, KH1 {Human (Homo sapiens) [TaxId: 9606]} asrfheqfivredlmglaigthganiqqarkvpgvtaidldedtctfhiygedqdavkka rsfle
Timeline for d2fmra_: