Lineage for d2fmr__ (2fmr -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32153Fold d.51: KH-domain [54790] (1 superfamily)
  4. 32154Superfamily d.51.1: KH-domain [54791] (1 family) (S)
  5. 32155Family d.51.1.1: KH-domain [54792] (6 proteins)
  6. 32156Protein Fragile X protein, KH1 [54799] (1 species)
  7. 32157Species Human (Homo sapiens) [TaxId:9606] [54800] (1 PDB entry)
  8. 32158Domain d2fmr__: 2fmr - [38808]

Details for d2fmr__

PDB Entry: 2fmr (more details)

PDB Description: kh1 from the fragile x protein fmr1, nmr, 18 structures

SCOP Domain Sequences for d2fmr__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fmr__ d.51.1.1 (-) Fragile X protein, KH1 {Human (Homo sapiens)}
asrfheqfivredlmglaigthganiqqarkvpgvtaidldedtctfhiygedqdavkka
rsfle

SCOP Domain Coordinates for d2fmr__:

Click to download the PDB-style file with coordinates for d2fmr__.
(The format of our PDB-style files is described here.)

Timeline for d2fmr__: