Lineage for d1ypna2 (1ypn A:220-306)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1648324Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 1648512Superfamily d.50.2: Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain [54782] (2 families) (S)
    automatically mapped to Pfam PF03900
  5. 1648513Family d.50.2.1: Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain [54783] (1 protein)
  6. 1648514Protein Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain [54784] (1 species)
  7. 1648515Species Escherichia coli [TaxId:562] [54785] (5 PDB entries)
  8. 1648520Domain d1ypna2: 1ypn A:220-306 [38797]
    Other proteins in same PDB: d1ypna1
    complexed with dpm; mutant

Details for d1ypna2

PDB Entry: 1ypn (more details), 2.3 Å

PDB Description: reduced form hydroxymethylbilane synthase (k59q mutant) crystal structure after 2 hours in a flow cell determined by time-resolved laue diffraction
PDB Compounds: (A:) hydroxymethylbilane synthase

SCOPe Domain Sequences for d1ypna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ypna2 d.50.2.1 (A:220-306) Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain {Escherichia coli [TaxId: 562]}
nhhetalrvtaeramntrleggcqvpigsyaelidgeiwlralvgapdgsqiirgerrga
pqdaeqmgislaeellnngareilaev

SCOPe Domain Coordinates for d1ypna2:

Click to download the PDB-style file with coordinates for d1ypna2.
(The format of our PDB-style files is described here.)

Timeline for d1ypna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ypna1