Lineage for d1ypn_2 (1ypn 220-306)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.50: dsRBD-like [54767] (3 superfamilies) Superfamily d.50.2: Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain [54782] (1 family) 
Family d.50.2.1: Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain [54783] (1 protein) Protein Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain [54784] (1 species) Species Escherichia coli [TaxId:562] [54785] (4 PDB entries) 
Domain d1ypn_2: 1ypn 220-306 [38797]
Other proteins in same PDB: d1ypn_1
Details for d1ypn_2
PDB Entry: 1ypn (more details), 2.3 Å
PDB Description: reduced form hydroxymethylbilane synthase (k59q mutant) crystal structure after 2 hours in a flow cell determined by time-resolved laue diffraction
SCOP Domain Sequences for d1ypn_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ypn_2 d.50.2.1 (220-306) Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain {Escherichia coli}
nhhetalrvtaeramntrleggcqvpigsyaelidgeiwlralvgapdgsqiirgerrga
pqdaeqmgislaeellnngareilaev
SCOP Domain Coordinates for d1ypn_2:
Click to download the PDB-style file with coordinates for d1ypn_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ypn_2:
- d1ypn_2 appears in SCOP 1.57
- d1ypn_2 appears in the current release, SCOPe 2.08, called d1ypna2
View in 3D
