Lineage for d6v09a1 (6v09 A:1-62)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638750Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 2638751Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) (S)
  5. 2638752Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
    Pfam PF00084
  6. 2638753Protein beta2-glycoprotein I [57543] (1 species)
    consists of five modules with the C-terminal module fold being altered
  7. 2638754Species Human (Homo sapiens) [TaxId:9606] [57544] (9 PDB entries)
  8. 2638774Domain d6v09a1: 6v09 A:1-62 [387890]
    Other proteins in same PDB: d6v09a6
    automated match to d1quba1
    complexed with bma, nag, so4

Details for d6v09a1

PDB Entry: 6v09 (more details), 2.99 Å

PDB Description: crystal structure of human recombinant beta-2 glycoprotein i short tag (st-b2gpi)
PDB Compounds: (A:) Beta-2-glycoprotein 1

SCOPe Domain Sequences for d6v09a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6v09a1 g.18.1.1 (A:1-62) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]}
grtcpkpddlpfstvvplktfyepgeeitysckpgyvsrggmrkficpltglwpintlkc
tp

SCOPe Domain Coordinates for d6v09a1:

Click to download the PDB-style file with coordinates for d6v09a1.
(The format of our PDB-style files is described here.)

Timeline for d6v09a1: