Class g: Small proteins [56992] (100 folds) |
Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) |
Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins) Pfam PF00084 |
Protein beta2-glycoprotein I [57543] (1 species) consists of five modules with the C-terminal module fold being altered |
Species Human (Homo sapiens) [TaxId:9606] [57544] (11 PDB entries) |
Domain d6v09a1: 6v09 A:1-62 [387890] Other proteins in same PDB: d6v09a6 automated match to d1quba1 complexed with nag, so4 |
PDB Entry: 6v09 (more details), 2.99 Å
SCOPe Domain Sequences for d6v09a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6v09a1 g.18.1.1 (A:1-62) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} grtcpkpddlpfstvvplktfyepgeeitysckpgyvsrggmrkficpltglwpintlkc tp
Timeline for d6v09a1: