Lineage for d1di2b_ (1di2 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946839Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 2946840Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) (S)
  5. 2946841Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins)
    Pfam PF00035
  6. 2946849Protein Double-stranded RNA-binding protein A, second dsRBD [54770] (1 species)
  7. 2946850Species African clawed frog (Xenopus laevis) [TaxId:8355] [54771] (1 PDB entry)
  8. 2946852Domain d1di2b_: 1di2 B: [38781]
    complexed with dsRNA
    protein/RNA complex

Details for d1di2b_

PDB Entry: 1di2 (more details), 1.9 Å

PDB Description: crystal structure of a dsrna-binding domain complexed with dsrna: molecular basis of double-stranded rna-protein interactions
PDB Compounds: (B:) double stranded RNA binding protein a

SCOPe Domain Sequences for d1di2b_:

Sequence, based on SEQRES records: (download)

>d1di2b_ d.50.1.1 (B:) Double-stranded RNA-binding protein A, second dsRBD {African clawed frog (Xenopus laevis) [TaxId: 8355]}
mpvgslqelavqkgwrlpeytvaqesgpphkreftitcrvetfvetgsgtskqvakrvaa
eklltkfkt

Sequence, based on observed residues (ATOM records): (download)

>d1di2b_ d.50.1.1 (B:) Double-stranded RNA-binding protein A, second dsRBD {African clawed frog (Xenopus laevis) [TaxId: 8355]}
mpvgslqelavqkgwrlpeytvaqftitcrvetfvetgsgtskqvakrvaaeklltkfkt

SCOPe Domain Coordinates for d1di2b_:

Click to download the PDB-style file with coordinates for d1di2b_.
(The format of our PDB-style files is described here.)

Timeline for d1di2b_: