PDB entry 1di2

View 1di2 on RCSB PDB site
Description: crystal structure of a dsRNA-binding domain complexed with dsRNA: molecular basis of double-stranded RNA-protein interactions
Class: RNA binding protein/RNA
Keywords: protein-RNA complex, double stranded RNA, protein-RNA interactions, RNA-bining protein, RNA binding protein/RNA complex
Deposited on 1999-11-28, released 1999-12-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.228
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: double stranded RNA binding protein a
  Species: Xenopus laevis [TaxId:8355]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q91836 (0-68)
    • engineered (0)
  Domains in SCOPe 2.08: d1di2a_
• Chain 'B':
  Compound: double stranded RNA binding protein a
  Species: Xenopus laevis [TaxId:8355]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q91836 (0-68)
    • engineered (0)
  Domains in SCOPe 2.08: d1di2b_
• Chain 'C':
  Compound: RNA (5'-r(*gp*gp*cp*gp*cp*gp*cp*gp*cp*c)-3')
  Species: synthetic, synthetic
  
• Chain 'D':
  Compound: RNA (5'-r(*gp*gp*cp*gp*cp*gp*cp*gp*cp*c)-3')
  Species: synthetic, synthetic
  
• Chain 'E':
  Compound: RNA (5'-r(*gp*gp*cp*gp*cp*gp*cp*gp*cp*c)-3')
  Species: synthetic, synthetic
  
• Chain 'G':
  Compound: RNA (5'-r(*gp*gp*cp*gp*cp*gp*cp*gp*cp*c)-3')
  Species: synthetic, synthetic
  
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1di2A (A:)
  mpvgslqelavqkgwrlpeytvaqesgpphkreftitcrvetfvetgsgtskqvakrvaa
  eklltkfkt
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >1di2B (B:)
  mpvgslqelavqkgwrlpeytvaqesgpphkreftitcrvetfvetgsgtskqvakrvaa
  eklltkfkt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1di2B (B:)
  mpvgslqelavqkgwrlpeytvaqftitcrvetfvetgsgtskqvakrvaaeklltkfkt
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.