Lineage for d1di2a_ (1di2 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1025346Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 1025347Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) (S)
  5. 1025348Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins)
    Pfam PF00035
  6. 1025356Protein Double-stranded RNA-binding protein A, second dsRBD [54770] (1 species)
  7. 1025357Species African clawed frog (Xenopus laevis) [TaxId:8355] [54771] (1 PDB entry)
  8. 1025358Domain d1di2a_: 1di2 A: [38780]
    complexed with dsRNA
    protein/RNA complex

Details for d1di2a_

PDB Entry: 1di2 (more details), 1.9 Å

PDB Description: crystal structure of a dsrna-binding domain complexed with dsrna: molecular basis of double-stranded rna-protein interactions
PDB Compounds: (A:) double stranded RNA binding protein a

SCOPe Domain Sequences for d1di2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1di2a_ d.50.1.1 (A:) Double-stranded RNA-binding protein A, second dsRBD {African clawed frog (Xenopus laevis) [TaxId: 8355]}
mpvgslqelavqkgwrlpeytvaqesgpphkreftitcrvetfvetgsgtskqvakrvaa
eklltkfkt

SCOPe Domain Coordinates for d1di2a_:

Click to download the PDB-style file with coordinates for d1di2a_.
(The format of our PDB-style files is described here.)

Timeline for d1di2a_: