PDB entry 1di2
View 1di2 on RCSB PDB site
Description: crystal structure of a dsRNA-binding domain complexed with dsRNA: molecular basis of double-stranded RNA-protein interactions
Class: RNA binding protein/RNA
Keywords: protein-RNA complex, double stranded RNA, protein-RNA interactions, RNA-bining protein, RNA binding protein/RNA complex
Deposited on
1999-11-28, released
1999-12-02
The last revision prior to the SCOPe 2.01 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.228
AEROSPACI score: 0.47
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: double stranded RNA binding protein a
Species: Xenopus laevis [TaxId:8355]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d1di2a_ - Chain 'B':
Compound: double stranded RNA binding protein a
Species: Xenopus laevis [TaxId:8355]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d1di2b_ - Chain 'C':
Compound: RNA (5'-r(*gp*gp*cp*gp*cp*gp*cp*gp*cp*c)-3')
Species: synthetic, synthetic
- Chain 'D':
Compound: RNA (5'-r(*gp*gp*cp*gp*cp*gp*cp*gp*cp*c)-3')
Species: synthetic, synthetic
- Chain 'E':
Compound: RNA (5'-r(*gp*gp*cp*gp*cp*gp*cp*gp*cp*c)-3')
Species: synthetic, synthetic
- Chain 'G':
Compound: RNA (5'-r(*gp*gp*cp*gp*cp*gp*cp*gp*cp*c)-3')
Species: synthetic, synthetic
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1di2A (A:)
mpvgslqelavqkgwrlpeytvaqesgpphkreftitcrvetfvetgsgtskqvakrvaa
eklltkfkt
- Chain 'B':
Sequence, based on SEQRES records: (download)
>1di2B (B:)
mpvgslqelavqkgwrlpeytvaqesgpphkreftitcrvetfvetgsgtskqvakrvaa
eklltkfkt
Sequence, based on observed residues (ATOM records): (download)
>1di2B (B:)
mpvgslqelavqkgwrlpeytvaqftitcrvetfvetgsgtskqvakrvaaeklltkfkt
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.
- Chain 'E':
No sequence available.
- Chain 'G':
No sequence available.