Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
Fold d.49: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54761] (1 superfamily) |
Superfamily d.49.1: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54762] (1 family) |
Family d.49.1.1: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54763] (1 protein) |
Protein Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54764] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [54765] (2 PDB entries) |
Domain d1e8oa_: 1e8o A: [38773] |
PDB Entry: 1e8o (more details), 3.2 Å
SCOP Domain Sequences for d1e8oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e8oa_ d.49.1.1 (A:) Signal recognition particle alu RNA binding heterodimer, SRP9/14 {Human (Homo sapiens)} pqyqtweefsraaeklyladpmkarvvlkyrhsdgnlcvkvtddlvclvyktdqaqdvkk iekfhsqlmrlmva
Timeline for d1e8oa_: