Lineage for d1e8oc_ (1e8o C:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191583Fold d.49: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54761] (1 superfamily)
  4. 191584Superfamily d.49.1: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54762] (1 family) (S)
  5. 191585Family d.49.1.1: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54763] (1 protein)
  6. 191586Protein Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54764] (2 species)
  7. 191587Species Human (Homo sapiens) [TaxId:9606] [54765] (2 PDB entries)
  8. 191590Domain d1e8oc_: 1e8o C: [38774]

Details for d1e8oc_

PDB Entry: 1e8o (more details), 3.2 Å

PDB Description: core of the alu domain of the mammalian srp

SCOP Domain Sequences for d1e8oc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e8oc_ d.49.1.1 (C:) Signal recognition particle alu RNA binding heterodimer, SRP9/14 {Human (Homo sapiens)}
qtweefsraaeklyladpmkarvvlkyrhsdgnlcvkvtddlvclvyktdqaqdvkkiek
fhsqlmrlmva

SCOP Domain Coordinates for d1e8oc_:

Click to download the PDB-style file with coordinates for d1e8oc_.
(The format of our PDB-style files is described here.)

Timeline for d1e8oc_: