SCOPe 2.07: Domain d6kk4a_: 6kk4 A:

Lineage for d6kk4a_ (6kk4 A:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.96: Flavivirus non-structural protein NS2B-like [310561] (1 superfamily)

4. Superfamily g.96.1: Flavivirus non-structural protein NS2B-like [310588] (2 families)
   Pfam PF01002; see PubMed 16532006 for discussion of NS2B-NS3pro complex

5. Family g.96.1.0: automated matches [324385] (1 protein)
   not a true family

6. Protein automated matches [324386] (3 species)
   not a true protein

7. Species Zika virus [TaxId:64320] [327137] (14 PDB entries)

8. Domain d6kk4a_: 6kk4 A: [387725]
   Other proteins in same PDB: d6kk4b_
   automated match to d2ggva_
   complexed with de0, gol

Details for d6kk4a_

PDB Entry: 6kk4, 1.74 Å

PDB Description: crystal structure of zika ns2b-ns3 protease with compound 9

PDB Compounds: (A:) Serine protease subunit NS2B

SCOPe Domain Sequences for d6kk4a_:

Sequence; same for both SEQRES and ATOM records:

>d6kk4a_ g.96.1.0 (A:) automated matches {Zika virus [TaxId: 64320]}
vdmyieragditwekdaevtgnsprldvaldesgdfslv

Timeline for d6kk4a_:

• d6kk4a_ is new in SCOPe 2.07-stable
  
• d6kk4a_ appears in the current release, SCOPe 2.08