SCOPe 2.08: Domain d7btcd1: 7btc D:4-169

Lineage for d7btcd1 (7btc D:4-169)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein GTP-binding protein RheB [142275] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142276] (9 PDB entries)
   Uniprot Q15382 3-169

8. Domain d7btcd1: 7btc D:4-169 [387710]
   Other proteins in same PDB: d7btca2, d7btcb2, d7btcc2, d7btcd2
   automated match to d3t5ga_
   complexed with gdp; mutant

Details for d7btcd1

PDB Entry: 7btc, 2.1 Å

PDB Description: crystal structure of rheb y35n mutant bound to gdp

PDB Compounds: (D:) GTP-binding protein Rheb

SCOPe Domain Sequences for d7btcd1:

Sequence, based on SEQRES records:

>d7btcd1 c.37.1.8 (D:4-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]}
sksrkiailgyrsvgkssltiqfvegqfvdsndptientftklitvngqeyhlqlvdtag
qdeysifpqtysidingyilvysvtsiksfevikvihgklldmvgkvqipimlvgnkkdl
hmervisyeegkalaeswnaaflessakenqtavdvfrriileaek

Sequence, based on observed residues (ATOM records):

>d7btcd1 c.37.1.8 (D:4-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]}
sksrkiailgyrsvgkssltiqfvegqfvdstientftklitvngqeyhlqlvdtagqde
ysifpdingyilvysvtsiksfevikvihgklldmvgkvqipimlvgnkkdlhmervisy
eegkalaeswnaaflessakenqtavdvfrriileaek

Timeline for d7btcd1:

• d7btcd1 first appeared in SCOPe 2.07