Lineage for d6sbvg2 (6sbv G:161-332)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2604672Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2604673Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2604674Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2604681Protein Lactate dehydrogenase [56339] (20 species)
  7. 2604752Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [64445] (38 PDB entries)
  8. 2604901Domain d6sbvg2: 6sbv G:161-332 [387650]
    Other proteins in same PDB: d6sbva1, d6sbvb1, d6sbvc1, d6sbvd1, d6sbve1, d6sbvf1, d6sbvg1, d6sbvh1
    automated match to d4jnka2
    complexed with l5k

Details for d6sbvg2

PDB Entry: 6sbv (more details), 2.6 Å

PDB Description: x-ray structure of human ldh-a with an allosteric inhibitor (compound 7)
PDB Compounds: (G:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d6sbvg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6sbvg2 d.162.1.1 (G:161-332) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
sgcnldsarfrylmgerlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgt
dkdkeqwkevhkqvvesayeviklkgytswaiglsvadlaesimknlrrvhpvstmikgl
ygikddvflsvpcilgqngisdlvkvtltseeearlkksadtlwgiqkelqf

SCOPe Domain Coordinates for d6sbvg2:

Click to download the PDB-style file with coordinates for d6sbvg2.
(The format of our PDB-style files is described here.)

Timeline for d6sbvg2: