Lineage for d6sbvg1 (6sbv G:2-160)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2452663Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2452702Protein Lactate dehydrogenase [51859] (19 species)
  7. 2452768Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [63940] (38 PDB entries)
  8. 2452917Domain d6sbvg1: 6sbv G:2-160 [387649]
    Other proteins in same PDB: d6sbva2, d6sbvb2, d6sbvc2, d6sbvd2, d6sbve2, d6sbvf2, d6sbvg2, d6sbvh2
    automated match to d4jnka1
    complexed with l5k

Details for d6sbvg1

PDB Entry: 6sbv (more details), 2.6 Å

PDB Description: x-ray structure of human ldh-a with an allosteric inhibitor (compound 7)
PDB Compounds: (G:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d6sbvg1:

Sequence, based on SEQRES records: (download)

>d6sbvg1 c.2.1.5 (G:2-160) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkyspnckllivsnpvdiltyvawkisgfpknrvig

Sequence, based on observed residues (ATOM records): (download)

>d6sbvg1 c.2.1.5 (G:2-160) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
atlkdqliynllktpqnkitvvgvgavgmacaisilmkdladelalvdviedklkgemmd
lqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfiipnv
vkyspnckllivsnpvdiltyvawkisgfpknrvig

SCOPe Domain Coordinates for d6sbvg1:

Click to download the PDB-style file with coordinates for d6sbvg1.
(The format of our PDB-style files is described here.)

Timeline for d6sbvg1: