Class b: All beta proteins [48724] (178 folds) |
Fold b.182: U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain-like [345889] (1 superfamily) 10-stranded mixed beta sandwich with 3 helices surrounding the upper rim |
Superfamily b.182.1: U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain-like [345922] (1 family) N-terminal part of Pfam PF05282 |
Family b.182.1.1: U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain-like [345967] (2 proteins) |
Protein U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain [346065] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [346269] (140 PDB entries) |
Domain d5r1jb1: 5r1j B:1-152 [386936] Other proteins in same PDB: d5r1ja1, d5r1ja2, d5r1jb2 automated match to d3sbtb1 |
PDB Entry: 5r1j (more details), 1.96 Å
SCOPe Domain Sequences for d5r1jb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5r1jb1 b.182.1.1 (B:1-152) U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} mntvpftsapievtigidqysfnvkenqpfhgikdipighvhvihfqhadnssmrygywf dcrmgnfyiqydpkdglykmmeerdgakfenivhnfkerqmmvsypkideddtwynltef vqmdkirkivrkdenqfsyvdssmttvqenel
Timeline for d5r1jb1: