Lineage for d3sbtb1 (3sbt B:1-153)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2434545Fold b.182: U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain-like [345889] (1 superfamily)
    10-stranded mixed beta sandwich with 3 helices surrounding the upper rim
  4. 2434546Superfamily b.182.1: U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain-like [345922] (1 family) (S)
    N-terminal part of Pfam PF05282
  5. 2434547Family b.182.1.1: U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain-like [345967] (2 proteins)
  6. 2434548Protein U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain [346065] (1 species)
  7. 2434549Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [346269] (140 PDB entries)
  8. 2434556Domain d3sbtb1: 3sbt B:1-153 [343863]
    Other proteins in same PDB: d3sbta1, d3sbta2, d3sbtb2
    automated match to d3sbsa1
    complexed with pgo, so4

Details for d3sbtb1

PDB Entry: 3sbt (more details), 1.8 Å

PDB Description: Crystal structure of a Aar2-Prp8 complex
PDB Compounds: (B:) A1 cistron-splicing factor AAR2

SCOPe Domain Sequences for d3sbtb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sbtb1 b.182.1.1 (B:1-153) U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mntvpftsapievtigidqysfnvkenqpfhgikdipighvhvihfqhadnssmrygywf
dcrmgnfyiqydpkdglykmmeerdgakfenivhnfkerqmmvsypkideddtwynltef
vqmdkirkivrkdenqfsyvdssmttvqenell

SCOPe Domain Coordinates for d3sbtb1:

Click to download the PDB-style file with coordinates for d3sbtb1.
(The format of our PDB-style files is described here.)

Timeline for d3sbtb1:

2434556
d3sbtb1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d3sbtb2