| Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
| Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) ![]() |
| Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins) |
| Protein Mn superoxide dismutase (MnSOD) [54721] (6 species) |
| Species Escherichia coli [TaxId:562] [54722] (10 PDB entries) |
| Domain d1i0ha2: 1i0h A:91-205 [38685] Other proteins in same PDB: d1i0ha1, d1i0hb1 |
PDB Entry: 1i0h (more details), 1.35 Å
SCOP Domain Sequences for d1i0ha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i0ha2 d.44.1.1 (A:91-205) Mn superoxide dismutase (MnSOD) {Escherichia coli}
gttlqgdlkaaierdfgsvdnfkaefekaaasrfgsgwawlvlkgdklavvstanqdspl
mgeaisgasgfpimgldvwehayflkfqnrrpdyikefwnvvnwdeaaarfaakk
Timeline for d1i0ha2: