Lineage for d1i0ha2 (1i0h A:91-205)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 256440Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 256441Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 256442Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 256518Protein Mn superoxide dismutase (MnSOD) [54721] (6 species)
  7. 256529Species Escherichia coli [TaxId:562] [54722] (10 PDB entries)
  8. 256534Domain d1i0ha2: 1i0h A:91-205 [38685]
    Other proteins in same PDB: d1i0ha1, d1i0hb1

Details for d1i0ha2

PDB Entry: 1i0h (more details), 1.35 Å

PDB Description: crystal structure of the e. coli manganese superoxide dismutase mutant y174f at 1.35 angstroms resolution.

SCOP Domain Sequences for d1i0ha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i0ha2 d.44.1.1 (A:91-205) Mn superoxide dismutase (MnSOD) {Escherichia coli}
gttlqgdlkaaierdfgsvdnfkaefekaaasrfgsgwawlvlkgdklavvstanqdspl
mgeaisgasgfpimgldvwehayflkfqnrrpdyikefwnvvnwdeaaarfaakk

SCOP Domain Coordinates for d1i0ha2:

Click to download the PDB-style file with coordinates for d1i0ha2.
(The format of our PDB-style files is described here.)

Timeline for d1i0ha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i0ha1