SCOPe 2.07: Domain d6qbab_: 6qba B:

Lineage for d6qbab_ (6qba B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (4 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.1: "Histone-like" proteins from archaea [54161] (2 proteins)

6. Protein automated matches [190114] (2 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:2287] [337247] (4 PDB entries)

8. Domain d6qbab_: 6qba B: [386761]
   Other proteins in same PDB: d6qbaa_
   automated match to d5ufqd_
   complexed with 2t1, act, imd, peg, zn

Details for d6qbab_

PDB Entry: 6qba, 1.8 Å

PDB Description: crystal structure of retinol-binding protein 4 (rbp4) in complex with non-retinoid ligand a1120 and engineered binding scaffold

PDB Compounds: (B:) DNA-binding protein 7a

SCOPe Domain Sequences for d6qbab_:

Sequence; same for both SEQRES and ATOM records:

>d6qbab_ b.34.13.1 (B:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
atvkltyqgeekqvdiskikrvarygqniyfsydegggaydygavsekdapkellqmlek
q

Timeline for d6qbab_:

• d6qbab_ is new in SCOPe 2.07-stable
  
• d6qbab_ appears in the current release, SCOPe 2.08