PDB entry 6qba

View 6qba on RCSB PDB site
Description: Crystal Structure of Retinol-Binding Protein 4 (RBP4) in complex with non-retinoid ligand A1120 and engineered binding scaffold
Class: transport protein
Keywords: Lipocalin, RBP4, Retinol binding protein, TRANSPORT PROTEIN
Deposited on 2018-12-20, released 2020-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-06-03, with a file datestamp of 2020-05-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: retinol-binding protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: RBP4, PRO2222
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6qbaa_
  • Chain 'B':
    Compound: DNA-binding protein 7a
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: sso7a1, sso7d-2, SSO9180, sso7a2, sso7d-3, SSO9535
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61991 (0-60)
      • conflict (4-5)
      • conflict (7)
      • conflict (20)
      • conflict (22)
      • conflict (24)
      • conflict (26-27)
      • conflict (29)
      • conflict (31)
      • conflict (38-41)
    Domains in SCOPe 2.07: d6qbab_
  • Heterogens: 2T1, IMD, PEG, ZN, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6qbaA (A:)
    gperdcrvssfrvkenfdkarfsgtwyamakkdpeglflqdnivaefsvdetgqmsatak
    grvrllnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwivdtdydtyavqy
    scrllnldgtcadsysfvfsrdpnglppeaqkivrqrqeelclarqyrlivhngycdgrs
    ernll
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qbaA (A:)
    erdcrvssfrvkenfdkarfsgtwyamakkdpeglflqdnivaefsvdetgqmsatakgr
    vrllnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwivdtdydtyavqysc
    rllnldgtcadsysfvfsrdpnglppeaqkivrqrqeelclarqyrlivhngycdg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6qbaB (B:)
    atvkltyqgeekqvdiskikrvarygqniyfsydegggaydygavsekdapkellqmlek
    q