SCOPe 2.08: Domain d6vocc_: 6voc C:

Lineage for d6vocc_ (6voc C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.5: Bromoviridae-like VP [88639] (2 proteins)

6. Protein Cucumovirus coat protein [88640] (4 species)

7. Species BMV (Brome mosaic virus) [TaxId:12302] [74886] (3 PDB entries)

8. Domain d6vocc_: 6voc C: [385884]
   automated match to d1js9c_

Details for d6vocc_

PDB Entry: 6voc, 3.1 Å

PDB Description: icosahedral symmetry reconstruction of brome mosaic virus (rna 3+4)

PDB Compounds: (C:) capsid protein

SCOPe Domain Sequences for d6vocc_:

Sequence; same for both SEQRES and ATOM records:

>d6vocc_ b.121.4.5 (C:) Cucumovirus coat protein {BMV (Brome mosaic virus) [TaxId: 12302]}
rvqpviveplaagqgkaikaiagysiskweassdaitakatnamsitlphelsseknkel
kvgrvllwlgllpsvagrikacvaekqaqaeaafqvalavadsskevvaamytdafrgat
lgdllnlqiylyaseavpakavvvhlevehvrptfddfftpvyr

Timeline for d6vocc_:

• d6vocc_ first appeared in SCOPe 2.07