Lineage for d1fo4a3 (1fo4 A:537-694)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79412Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
  4. 79413Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (1 family) (S)
  5. 79414Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (3 proteins)
  6. 79429Protein Xanthine oxidase, domain 5 (?) [54670] (1 species)
  7. 79430Species Cow (Bos taurus) [TaxId:9913] [54671] (2 PDB entries)
  8. 79431Domain d1fo4a3: 1fo4 A:537-694 [38586]
    Other proteins in same PDB: d1fo4a1, d1fo4a2, d1fo4a4, d1fo4a5, d1fo4a6, d1fo4b1, d1fo4b2, d1fo4b4, d1fo4b5, d1fo4b6

Details for d1fo4a3

PDB Entry: 1fo4 (more details), 2.1 Å

PDB Description: crystal structure of xanthine dehydrogenase isolated from bovine milk

SCOP Domain Sequences for d1fo4a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fo4a3 d.41.1.1 (A:537-694) Xanthine oxidase, domain 5 (?) {Cow (Bos taurus)}
kldptytsatllfqkhppaniqlfqevpngqskedtvgrplphlaaamqasgeavycddi
pryenelflrlvtstrahakiksidvseaqkvpgfvcflsaddipgsnetglfndetvfa
kdtvtcvghiigavvadtpehaeraahvvkvtyedlpa

SCOP Domain Coordinates for d1fo4a3:

Click to download the PDB-style file with coordinates for d1fo4a3.
(The format of our PDB-style files is described here.)

Timeline for d1fo4a3: