Lineage for d1fo4a1 (1fo4 A:93-165)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 48597Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
  4. 48598Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (1 family) (S)
  5. 48599Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (3 proteins)
  6. 48614Protein Xanthine oxidase, domain 2 [47746] (1 species)
  7. 48615Species Cow (Bos taurus) [TaxId:9913] [47747] (2 PDB entries)
  8. 48616Domain d1fo4a1: 1fo4 A:93-165 [17910]
    Other proteins in same PDB: d1fo4a2, d1fo4a3, d1fo4a4, d1fo4a5, d1fo4a6, d1fo4b2, d1fo4b3, d1fo4b4, d1fo4b5, d1fo4b6

Details for d1fo4a1

PDB Entry: 1fo4 (more details), 2.1 Å

PDB Description: crystal structure of xanthine dehydrogenase isolated from bovine milk

SCOP Domain Sequences for d1fo4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fo4a1 a.56.1.1 (A:93-165) Xanthine oxidase, domain 2 {Cow (Bos taurus)}
stktrlhpvqeriakshgsqcgfctpgivmsmytllrnqpeptveeiedafqgnlcrctg
yrpilqgfrtfak

SCOP Domain Coordinates for d1fo4a1:

Click to download the PDB-style file with coordinates for d1fo4a1.
(The format of our PDB-style files is described here.)

Timeline for d1fo4a1: