Lineage for d1fo4b4 (1fo4 B:415-528)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 81993Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
  4. 82098Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (1 family) (S)
  5. 82099Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (2 proteins)
  6. 82109Protein Xanthine oxidase, domain 4 (?) [55452] (1 species)
  7. 82110Species Cow (Bos taurus) [TaxId:9913] [55453] (2 PDB entries)
  8. 82112Domain d1fo4b4: 1fo4 B:415-528 [40228]
    Other proteins in same PDB: d1fo4a1, d1fo4a2, d1fo4a3, d1fo4a5, d1fo4a6, d1fo4b1, d1fo4b2, d1fo4b3, d1fo4b5, d1fo4b6

Details for d1fo4b4

PDB Entry: 1fo4 (more details), 2.1 Å

PDB Description: crystal structure of xanthine dehydrogenase isolated from bovine milk

SCOP Domain Sequences for d1fo4b4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fo4b4 d.87.2.1 (B:415-528) Xanthine oxidase, domain 4 (?) {Cow (Bos taurus)}
deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql
skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklg

SCOP Domain Coordinates for d1fo4b4:

Click to download the PDB-style file with coordinates for d1fo4b4.
(The format of our PDB-style files is described here.)

Timeline for d1fo4b4: