SCOPe 2.08: Domain d6k2ea_: 6k2e A:

Lineage for d6k2ea_ (6k2e A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.58: CRISPR associated protein Cas2-like [143430] (2 families)
   contains extra C-terminal beta-strand that integrates into the beta-sheet of the other subunit in the homodimer, a probable biological unit of this superfamily

5. Family d.58.58.0: automated matches [191564] (1 protein)
   not a true family

6. Protein automated matches [190980] (6 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:70601] [385756] (1 PDB entry)

8. Domain d6k2ea_: 6k2e A: [385757]
   automated match to d4tnoa_

Details for d6k2ea_

PDB Entry: 6k2e, 2.8 Å

PDB Description: crystal structure of cas2

PDB Compounds: (A:) CRISPR/cas2 protein

SCOPe Domain Sequences for d6k2ea_:

Sequence; same for both SEQRES and ATOM records:

>d6k2ea_ d.58.58.0 (A:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
gshmyvivvydvnvervnrvhkllktylfwrqnsvfegelskaqlyelemrlkrivkedd
svliyifpgknfdlhvvgrdkspvemii

Timeline for d6k2ea_:

• d6k2ea_ first appeared in SCOPe 2.07