Lineage for d4tnoa_ (4tno A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2956212Superfamily d.58.58: CRISPR associated protein Cas2-like [143430] (2 families) (S)
    contains extra C-terminal beta-strand that integrates into the beta-sheet of the other subunit in the homodimer, a probable biological unit of this superfamily
  5. 2956213Family d.58.58.1: CRISPR associated protein Cas2-like [143431] (5 proteins)
    Pfam PF09827
  6. 2956223Protein Hypothetical protein PF1117 [160346] (1 species)
  7. 2956224Species Pyrococcus furiosus [TaxId:2261] [160347] (2 PDB entries)
    Uniprot Q8U1T8 1-84
  8. 2956225Domain d4tnoa_: 4tno A: [261602]
    automated match to d2i0xa1
    complexed with cl

Details for d4tnoa_

PDB Entry: 4tno (more details), 2.14 Å

PDB Description: hypothetical protein pf1117 from pyrococcus furiosus: structure solved by sulfur-sad using swiss light source data
PDB Compounds: (A:) CRISPR-associated endoribonuclease Cas2

SCOPe Domain Sequences for d4tnoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tnoa_ d.58.58.1 (A:) Hypothetical protein PF1117 {Pyrococcus furiosus [TaxId: 2261]}
myivvvydvgvervnkvkkflrmhlnwvqnsvfegevtlaeferikeglkkiidensdsv
iiyklrsmppretlgieknpieei

SCOPe Domain Coordinates for d4tnoa_:

Click to download the PDB-style file with coordinates for d4tnoa_.
(The format of our PDB-style files is described here.)

Timeline for d4tnoa_: