![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.58: CRISPR associated protein Cas2-like [143430] (2 families) ![]() contains extra C-terminal beta-strand that integrates into the beta-sheet of the other subunit in the homodimer, a probable biological unit of this superfamily |
![]() | Family d.58.58.1: CRISPR associated protein Cas2-like [143431] (5 proteins) Pfam PF09827 |
![]() | Protein Hypothetical protein PF1117 [160346] (1 species) |
![]() | Species Pyrococcus furiosus [TaxId:2261] [160347] (2 PDB entries) Uniprot Q8U1T8 1-84 |
![]() | Domain d4tnoa_: 4tno A: [261602] automated match to d2i0xa1 complexed with cl |
PDB Entry: 4tno (more details), 2.14 Å
SCOPe Domain Sequences for d4tnoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tnoa_ d.58.58.1 (A:) Hypothetical protein PF1117 {Pyrococcus furiosus [TaxId: 2261]} myivvvydvgvervnkvkkflrmhlnwvqnsvfegevtlaeferikeglkkiidensdsv iiyklrsmppretlgieknpieei
Timeline for d4tnoa_: