Lineage for d6v5te_ (6v5t E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2795761Protein Thrombin [50531] (2 species)
  7. 2795797Species Human (Homo sapiens) [TaxId:9606] [50532] (171 PDB entries)
    Uniprot P00734 331-361,364-421 ! Uniprot P00734 334-360 364-510 518-619 ! Uniprot P00734 328-620 ! Uniprot P00734 355-621 ! Uniprot P00734 328-620
  8. 2795930Domain d6v5te_: 6v5t E: [385613]
    automated match to d1doja_
    complexed with gol, so4

Details for d6v5te_

PDB Entry: 6v5t (more details), 2.1 Å

PDB Description: crystal structure of human prethrombin-2 with tryptophans replaced by 5-f-tryptophan
PDB Compounds: (E:) Prothrombin

SCOPe Domain Sequences for d6v5te_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6v5te_ b.47.1.2 (E:) Thrombin {Human (Homo sapiens) [TaxId: 9606]}
eadcglrplfekksledkterellesyidgrivegsdaeigmspwqvmlfrkspqellcg
aslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihpr
ynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketwt
anvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpf
vmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge

SCOPe Domain Coordinates for d6v5te_:

Click to download the PDB-style file with coordinates for d6v5te_.
(The format of our PDB-style files is described here.)

Timeline for d6v5te_: