SCOPe 2.08: Domain d6leaa_: 6lea A:

Lineage for d6leaa_ (6lea A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.19: Flagellar export chaperone FliS [101116] (2 families)
   can form closed, open and helix-swapped bundles

5. Family a.24.19.0: automated matches [191633] (1 protein)
   not a true family

6. Protein automated matches [191166] (3 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:992013] [385386] (1 PDB entry)

8. Domain d6leaa_: 6lea A: [385409]
   automated match to d3iqca_

Details for d6leaa_

PDB Entry: 6lea, 2.95 Å

PDB Description: structure of flis chaperone in complex with flagellin and hp1076

PDB Compounds: (A:) Flagellar secretion chaperone FliS

SCOPe Domain Sequences for d6leaa_:

Sequence; same for both SEQRES and ATOM records:

>d6leaa_ a.24.19.0 (A:) automated matches {Helicobacter pylori [TaxId: 992013]}
espakliemlyegilrfssqakrcienediekkiyyinrvtdiftellnildyekggeva
vyltglythqikvltqanvendaskidlvlnvarglleawreihs

Timeline for d6leaa_:

• d6leaa_ first appeared in SCOPe 2.07