SCOPe 2.07: Domain d6kkmb1: 6kkm B:22-150

Lineage for d6kkmb1 (6kkm B:22-150)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.0: automated matches [227234] (1 protein)
   not a true family

6. Protein automated matches [226983] (27 species)
   not a true protein

7. Species Nostoc sp. [TaxId:103690] [385346] (2 PDB entries)

8. Domain d6kkmb1: 6kkm B:22-150 [385353]
   Other proteins in same PDB: d6kkma2, d6kkmb2, d6kkmc2, d6kkmd2
   automated match to d1ir2u2

Details for d6kkmb1

PDB Entry: 6kkm, 3 Å

PDB Description: crystal structure of rbcl-raf1 complex from anabaena sp. pcc 7120

PDB Compounds: (B:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d6kkmb1:

Sequence; same for both SEQRES and ATOM records:

>d6kkmb1 d.58.9.0 (B:22-150) automated matches {Nostoc sp. [TaxId: 103690]}
rltyytpdytpkdtdilaafrvtpqpgvpfeeaaaavaaesstgtwttvwtdlltdldry
kgrcydiepvpgednqfiayiaypldlfeegsitnvltsivgnvfgfkalralrledirf
pvayiktfq

Timeline for d6kkmb1:

• d6kkmb1 is new in SCOPe 2.07-stable
  
• d6kkmb1 appears in the current release, SCOPe 2.08