Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) C-terminal domain is beta/alpha barrel |
Family d.58.9.0: automated matches [227234] (1 protein) not a true family |
Protein automated matches [226983] (27 species) not a true protein |
Species Nostoc sp. [TaxId:103690] [385346] (2 PDB entries) |
Domain d6kkmb1: 6kkm B:22-150 [385353] Other proteins in same PDB: d6kkma2, d6kkmb2, d6kkmc2, d6kkmd2 automated match to d1ir2u2 |
PDB Entry: 6kkm (more details), 3 Å
SCOPe Domain Sequences for d6kkmb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6kkmb1 d.58.9.0 (B:22-150) automated matches {Nostoc sp. [TaxId: 103690]} rltyytpdytpkdtdilaafrvtpqpgvpfeeaaaavaaesstgtwttvwtdlltdldry kgrcydiepvpgednqfiayiaypldlfeegsitnvltsivgnvfgfkalralrledirf pvayiktfq
Timeline for d6kkmb1: