Lineage for d6kkmb1 (6kkm B:22-150)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2952777Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2952998Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2952999Protein automated matches [226983] (27 species)
    not a true protein
  7. 2953121Species Nostoc sp. [TaxId:103690] [385346] (2 PDB entries)
  8. 2953131Domain d6kkmb1: 6kkm B:22-150 [385353]
    Other proteins in same PDB: d6kkma2, d6kkmb2, d6kkmc2, d6kkmd2
    automated match to d1ir2u2

Details for d6kkmb1

PDB Entry: 6kkm (more details), 3 Å

PDB Description: crystal structure of rbcl-raf1 complex from anabaena sp. pcc 7120
PDB Compounds: (B:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d6kkmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6kkmb1 d.58.9.0 (B:22-150) automated matches {Nostoc sp. [TaxId: 103690]}
rltyytpdytpkdtdilaafrvtpqpgvpfeeaaaavaaesstgtwttvwtdlltdldry
kgrcydiepvpgednqfiayiaypldlfeegsitnvltsivgnvfgfkalralrledirf
pvayiktfq

SCOPe Domain Coordinates for d6kkmb1:

Click to download the PDB-style file with coordinates for d6kkmb1.
(The format of our PDB-style files is described here.)

Timeline for d6kkmb1: