Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (5 families) |
Family d.32.1.3: Extradiol dioxygenases [54602] (4 proteins) duplication: consists of 2 similar domains with 2 repeats in each Similar to the Methylmalonyl-CoA epimerase dimer |
Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (1 species) |
Species Pseudomonas fluorescens [TaxId:294] [54609] (1 PDB entry) |
Domain d1cjxb2: 1cjx B:154-356 [38519] |
PDB Entry: 1cjx (more details), 2.4 Å
SCOP Domain Sequences for d1cjxb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cjxb2 d.32.1.3 (B:154-356) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens} aglkvidhlthnvyrgrmvywanfyeklfnfrearyfdikgeytgltskamsapdgmiri plneesskgagqieeflmqfngegiqhvafltddlvktwdalkkigmrfmtappdtyyem legrlpdhgepvdqlqargilldgssvegdkrlllqifsetlmgpvffefiqrkgddgfg egnfkalfesierdqvrrgvlat
Timeline for d1cjxb2: