SCOP 1.65: Domain d1cjxc2: 1cjx C:154-356

Lineage for d1cjxc2 (1cjx C:154-356)

Root: SCOP 1.65
Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
beta-alpha-beta(3); 2 layers: alpha/beta
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (5 families)
Family d.32.1.3: Extradiol dioxygenases [54602] (4 proteins)
duplication: consists of 2 similar domains with 2 repeats in each
Similar to the Methylmalonyl-CoA epimerase dimer
Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (1 species)
Species Pseudomonas fluorescens [TaxId:294] [54609] (1 PDB entry)
Domain d1cjxc2: 1cjx C:154-356 [38521]

Details for d1cjxc2

PDB Entry: 1cjx (more details), 2.4 Å

PDB Description: crystal structure of pseudomonas fluorescens hppd

SCOP Domain Sequences for d1cjxc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cjxc2 d.32.1.3 (C:154-356) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens}
aglkvidhlthnvyrgrmvywanfyeklfnfrearyfdikgeytgltskamsapdgmiri
plneesskgagqieeflmqfngegiqhvafltddlvktwdalkkigmrfmtappdtyyem
legrlpdhgepvdqlqargilldgssvegdkrlllqifsetlmgpvffefiqrkgddgfg
egnfkalfesierdqvrrgvlat

SCOP Domain Coordinates for d1cjxc2:

Click to download the PDB-style file with coordinates for d1cjxc2.
(The format of our PDB-style files is described here.)

Timeline for d1cjxc2: