SCOP 1.65: Domain d1cjxc1: 1cjx C:4-153

Lineage for d1cjxc1 (1cjx C:4-153)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (5 families)

5. Family d.32.1.3: Extradiol dioxygenases [54602] (4 proteins)
   duplication: consists of 2 similar domains with 2 repeats in each
   Similar to the Methylmalonyl-CoA epimerase dimer

6. Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (1 species)

7. Species Pseudomonas fluorescens [TaxId:294] [54609] (1 PDB entry)

8. Domain d1cjxc1: 1cjx C:4-153 [38520]

Details for d1cjxc1

PDB Entry: 1cjx, 2.4 Å

PDB Description: crystal structure of pseudomonas fluorescens hppd

SCOP Domain Sequences for d1cjxc1:

Sequence; same for both SEQRES and ATOM records:

>d1cjxc1 d.32.1.3 (C:4-153) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens}
yenpmglmgfefiefasptpgtlepifeimgftkvathrsknvhlyrqgeinlilnnepn
siasyfaaehgpsvcgmafrvkdsqkaynralelgaqpihidtgpmelnlpaikgiggap
lylidrfgegssiydidfvylegvernpvg

Timeline for d1cjxc1:

• d1cjxc1 first appeared (with stable ids) in SCOP 1.55
  
• d1cjxc1 appears in SCOP 1.63
  
• d1cjxc1 appears in SCOP 1.67
  
• d1cjxc1 appears in the current release, SCOPe 2.08