Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein Ubiquitin [54238] (9 species) |
Species Human (Homo sapiens) [TaxId:9606] [54239] (312 PDB entries) Uniprot P62988 identical sequence in many other species |
Domain d6sqof1: 6sqo F:1-76 [385045] Other proteins in same PDB: d6sqob_, d6sqoc2, d6sqoe_, d6sqof2 automated match to d4k1rb_ complexed with cl, no3, zn |
PDB Entry: 6sqo (more details), 1.41 Å
SCOPe Domain Sequences for d6sqof1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6sqof1 d.15.1.1 (F:1-76) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrlrgg
Timeline for d6sqof1:
View in 3D Domains from other chains: (mouse over for more information) d6sqob_, d6sqoc1, d6sqoc2, d6sqoe_ |