Lineage for d1dhya1 (1dhy A:1-132)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
beta-alpha-beta(3); 2 layers: alpha/betaSuperfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) 
Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
duplication: consists of 2 similar domains with 2 repeats in each
Similar to the Methylmalonyl-CoA epimerase dimer
Protein 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) [54603] (2 species) Species Pseudomonas sp. [TaxId:306] [54604] (11 PDB entries) 
Domain d1dhya1: 1dhy A:1-132 [38504]
complexed with fe
Details for d1dhya1
PDB Entry: 1dhy (more details), 2.3 Å
PDB Description: kks102 bphc enzyme
PDB Compounds: (A:) 2,3-dihydroxybiphenyl 1,2-dioxygenaseSCOPe Domain Sequences for d1dhya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dhya1 d.32.1.3 (A:1-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]}
sierlgylgfavkdvpawdhfltksvglmaagsagdaalyradqrawriavqpgelddla
yaglevddaaalermadklrqagvaftrgdealmqqrkvmgllclqdpfglpleiyygpa
eifhepflpsap
SCOPe Domain Coordinates for d1dhya1:
Click to download the PDB-style file with coordinates for d1dhya1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dhya1:
- d1dhya1 first appeared (with stable ids) in SCOP 1.55, called d1dhy_1
- d1dhya1 appears in SCOPe 2.07
View in 3D
