PDB entry 1dhy

View 1dhy on RCSB PDB site
Description: kks102 bphc enzyme
Class: oxidoreductase (oxygenase)
Keywords: extradiol type dioxygenase, oxidoreductase (oxygenase)
Deposited on 1995-07-07, released 1995-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.186
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2,3-dihydroxybiphenyl 1,2-dioxygenase
    Species: Pseudomonas sp. [TaxId:306]
    Gene: BPHC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dhya1, d1dhya2
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dhyA (A:)
    sierlgylgfavkdvpawdhfltksvglmaagsagdaalyradqrawriavqpgelddla
    yaglevddaaalermadklrqagvaftrgdealmqqrkvmgllclqdpfglpleiyygpa
    eifhepflpsapvsgfvtgdqgighfvrcvpdtakamafytevlgfvlsdiidiqmgpet
    svpahflhcngrhhtialaafpipkrihhfmlqantiddvgyafdrldaagritsllgrh
    tndqtlsfyadtpspmievefgwgprtvdsswtvarhsrtamwghksvrgqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dhyA (A:)
    sierlgylgfavkdvpawdhfltksvglmaagsagdaalyradqrawriavqpgelddla
    yaglevddaaalermadklrqagvaftrgdealmqqrkvmgllclqdpfglpleiyygpa
    eifhepflpsapvsgfvtgdqgighfvrcvpdtakamafytevlgfvlsdiidivpahfl
    hcngrhhtialaafpipkrihhfmlqantiddvgyafdrldaagritsllgrhtndqtls
    fyadtpspmievefgwgprtvwtvarhsrtamwghksv