SCOPe 2.08: Domain d6ltma_: 6ltm A:

Lineage for d6ltma_ (6ltm A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (11 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46474] (96 PDB entries)

8. Domain d6ltma_: 6ltm A: [384986]
   automated match to d3vm9a_
   complexed with hem

Details for d6ltma_

PDB Entry: 6ltm, 1.65 Å

PDB Description: the dimeric structure of g80a/h81a/h82a myoglobin

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d6ltma_:

Sequence; same for both SEQRES and ATOM records:

>d6ltma_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkaaaeaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg

Timeline for d6ltma_:

• d6ltma_ first appeared in SCOPe 2.07