Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
Protein Lactate dehydrogenase [51859] (19 species) |
Species Lactobacillus casei [TaxId:1582] [51865] (4 PDB entries) |
Domain d6jmle1: 6jml E:4-150 [384947] Other proteins in same PDB: d6jmla2, d6jmlb2, d6jmlc2, d6jmld2, d6jmle2, d6jmlf2 automated match to d1llca1 complexed with so4 |
PDB Entry: 6jml (more details), 2.3 Å
SCOPe Domain Sequences for d6jmle1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jmle1 c.2.1.5 (E:4-150) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]} itdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpftsp kkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngiflv aanpvdiltyatwklsgfpknrvvgsg
Timeline for d6jmle1: