Lineage for d1qtoa_ (1qto A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1645158Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 1645159Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 1645207Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins)
    duplication: consists of two clear structural repeats each having this fold
    subunit fold and dimeric assembly are similar to those of glyoxalase
  6. 1645208Protein Bleomycin resistance protein, BRP [54599] (3 species)
    Active as dimer
  7. 1645228Species Streptomyces verticillus [TaxId:29309] [54600] (3 PDB entries)
  8. 1645229Domain d1qtoa_: 1qto A: [38494]

Details for d1qtoa_

PDB Entry: 1qto (more details), 1.5 Å

PDB Description: 1.5 a crystal structure of a bleomycin resistance determinant from bleomycin-producing streptomyces verticillus
PDB Compounds: (A:) bleomycin-binding protein

SCOPe Domain Sequences for d1qtoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qtoa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptomyces verticillus [TaxId: 29309]}
mvkflgavpvltavdvpanvsfwvdtlgfekdfgdrdfagvrrgdirlhisrtehqivad
ntsawievtdpdalheewaravstdyadtsgpamtpvgespagrefavrdpagncvhfta
ge

SCOPe Domain Coordinates for d1qtoa_:

Click to download the PDB-style file with coordinates for d1qtoa_.
(The format of our PDB-style files is described here.)

Timeline for d1qtoa_: