Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins) duplication: consists of two clear structural repeats each having this fold subunit fold and dimeric assembly are similar to those of glyoxalase |
Protein Bleomycin resistance protein, BRP [54599] (3 species) Active as dimer |
Species Streptomyces verticillus [TaxId:29309] [54600] (3 PDB entries) |
Domain d1qtoa_: 1qto A: [38494] |
PDB Entry: 1qto (more details), 1.5 Å
SCOPe Domain Sequences for d1qtoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qtoa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptomyces verticillus [TaxId: 29309]} mvkflgavpvltavdvpanvsfwvdtlgfekdfgdrdfagvrrgdirlhisrtehqivad ntsawievtdpdalheewaravstdyadtsgpamtpvgespagrefavrdpagncvhfta ge
Timeline for d1qtoa_: