PDB entry 1qto

View 1qto on RCSB PDB site
Description: 1.5 a crystal structure of a bleomycin resistance determinant from bleomycin-producing streptomyces verticillus
Class: antibiotic inhibitor
Keywords: arm-exchange, antibiotic inhibitor
Deposited on 1999-06-28, released 2000-06-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.19
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: bleomycin-binding protein
  Species: Streptomyces verticillus [TaxId:29309]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q53793 (0-121)
  Domains in SCOPe 2.04: d1qtoa_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qtoA (A:)
  mvkflgavpvltavdvpanvsfwvdtlgfekdfgdrdfagvrrgdirlhisrtehqivad
  ntsawievtdpdalheewaravstdyadtsgpamtpvgespagrefavrdpagncvhfta
  ge