| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (2 families) ![]() |
| Family b.1.12.0: automated matches [227279] (1 protein) not a true family |
| Protein automated matches [227090] (1 species) not a true protein |
| Species French bean (Phaseolus vulgaris) [TaxId:3885] [226471] (12 PDB entries) |
| Domain d6py9b1: 6py9 B:8-120 [384818] Other proteins in same PDB: d6py9a2, d6py9b2, d6py9c2, d6py9d2 automated match to d1kbpa1 complexed with act, ad9, edo, fe, flc, fuc, gol, ipa, na, nag, p4j, pge, so4, zn |
PDB Entry: 6py9 (more details), 2.2 Å
SCOPe Domain Sequences for d6py9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6py9b1 b.1.12.0 (B:8-120) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]}
nrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrk
riakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp
Timeline for d6py9b1: