Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (19 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [384692] (1 PDB entry) |
Domain d6lbpb1: 6lbp B:87-321 [384693] Other proteins in same PDB: d6lbpa2, d6lbpb2 automated match to d1ao0a2 complexed with sf4 |
PDB Entry: 6lbp (more details), 3.07 Å
SCOPe Domain Sequences for d6lbpb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6lbpb1 d.153.1.0 (B:87-321) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} cgvvgiygdseasrlcylalhalqhrgqegagivtvskdkvlqtitgvglvsevfseskl dqlpgdiaighvrystagssmlknvqpfvagyrfgsvgvahngnlvnytklradleengs ifntssdtevvlhliaiskarpffmrivdaceklqgaysmvfvtedklvavrdphgfrpl vmgrrsngavvfasetcaldlieatyerevypgevlvvdkdgvkcqclmphpepk
Timeline for d6lbpb1: