Lineage for d6lbpb1 (6lbp B:87-321)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2995888Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2995889Protein automated matches [190509] (19 species)
    not a true protein
  7. 2996493Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [384692] (1 PDB entry)
  8. 2996495Domain d6lbpb1: 6lbp B:87-321 [384693]
    Other proteins in same PDB: d6lbpa2, d6lbpb2
    automated match to d1ao0a2
    complexed with sf4

Details for d6lbpb1

PDB Entry: 6lbp (more details), 3.07 Å

PDB Description: structure of the glutamine phosphoribosylpyrophosphate amidotransferase from arabidopsis thaliana
PDB Compounds: (B:) Amidophosphoribosyltransferase 2, chloroplastic

SCOPe Domain Sequences for d6lbpb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6lbpb1 d.153.1.0 (B:87-321) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
cgvvgiygdseasrlcylalhalqhrgqegagivtvskdkvlqtitgvglvsevfseskl
dqlpgdiaighvrystagssmlknvqpfvagyrfgsvgvahngnlvnytklradleengs
ifntssdtevvlhliaiskarpffmrivdaceklqgaysmvfvtedklvavrdphgfrpl
vmgrrsngavvfasetcaldlieatyerevypgevlvvdkdgvkcqclmphpepk

SCOPe Domain Coordinates for d6lbpb1:

Click to download the PDB-style file with coordinates for d6lbpb1.
(The format of our PDB-style files is described here.)

Timeline for d6lbpb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6lbpb2