SCOPe 2.08: Domain d6lbpa1: 6lbp A:87-321

Lineage for d6lbpa1 (6lbp A:87-321)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.0: automated matches [191393] (1 protein)
   not a true family

6. Protein automated matches [190509] (19 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [384692] (1 PDB entry)

8. Domain d6lbpa1: 6lbp A:87-321 [384924]
   Other proteins in same PDB: d6lbpa2, d6lbpb2
   automated match to d1ao0a2
   complexed with sf4

Details for d6lbpa1

PDB Entry: 6lbp, 3.07 Å

PDB Description: structure of the glutamine phosphoribosylpyrophosphate amidotransferase from arabidopsis thaliana

PDB Compounds: (A:) Amidophosphoribosyltransferase 2, chloroplastic

SCOPe Domain Sequences for d6lbpa1:

Sequence; same for both SEQRES and ATOM records:

>d6lbpa1 d.153.1.0 (A:87-321) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
cgvvgiygdseasrlcylalhalqhrgqegagivtvskdkvlqtitgvglvsevfseskl
dqlpgdiaighvrystagssmlknvqpfvagyrfgsvgvahngnlvnytklradleengs
ifntssdtevvlhliaiskarpffmrivdaceklqgaysmvfvtedklvavrdphgfrpl
vmgrrsngavvfasetcaldlieatyerevypgevlvvdkdgvkcqclmphpepk

Timeline for d6lbpa1:

• d6lbpa1 first appeared in SCOPe 2.07