Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) automatically mapped to Pfam PF00574 |
Protein Clp protease, ClpP subunit [52098] (11 species) |
Species Escherichia coli [TaxId:562] [52099] (2 PDB entries) |
Domain d6uqep_: 6uqe P: [384527] Other proteins in same PDB: d6uqea1, d6uqea2, d6uqeb1, d6uqeb2, d6uqec1, d6uqec2, d6uqed1, d6uqed2, d6uqee1, d6uqee2, d6uqef1, d6uqef2 automated match to d1yg6a_ complexed with adp, ags |
PDB Entry: 6uqe (more details), 3 Å
SCOPe Domain Sequences for d6uqep_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6uqep_ c.14.1.1 (P:) Clp protease, ClpP subunit {Escherichia coli [TaxId: 562]} alvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav eyglvdsilthr
Timeline for d6uqep_: