Lineage for d6uqeq_ (6uqe Q:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2852295Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 2852296Protein Clp protease, ClpP subunit [52098] (11 species)
  7. 2852312Species Escherichia coli [TaxId:562] [52099] (2 PDB entries)
  8. 2852337Domain d6uqeq_: 6uqe Q: [384398]
    Other proteins in same PDB: d6uqea1, d6uqea2, d6uqeb1, d6uqeb2, d6uqec1, d6uqec2, d6uqed1, d6uqed2, d6uqee1, d6uqee2, d6uqef1, d6uqef2
    automated match to d1yg6a_
    complexed with adp, ags

Details for d6uqeq_

PDB Entry: 6uqe (more details), 3 Å

PDB Description: clpa/clpp disengaged state bound to repa-gfp
PDB Compounds: (Q:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d6uqeq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6uqeq_ c.14.1.1 (Q:) Clp protease, ClpP subunit {Escherichia coli [TaxId: 562]}
alvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
eyglvdsilthr

SCOPe Domain Coordinates for d6uqeq_:

Click to download the PDB-style file with coordinates for d6uqeq_.
(The format of our PDB-style files is described here.)

Timeline for d6uqeq_: