Lineage for d6y7ub_ (6y7u B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970344Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2970628Family d.110.3.0: automated matches [191387] (1 protein)
    not a true family
  6. 2970629Protein automated matches [190492] (24 species)
    not a true protein
  7. 2970646Species Chloroflexus aggregans [TaxId:326427] [368976] (15 PDB entries)
  8. 2970674Domain d6y7ub_: 6y7u B: [384525]
    Other proteins in same PDB: d6y7ua2
    automated match to d4eesa_
    complexed with fmn

Details for d6y7ub_

PDB Entry: 6y7u (more details), 1.6 Å

PDB Description: structure of chloroflexus aggregans cagg_3753 lov domain c85a a95p variant (cagfbfp)
PDB Compounds: (B:) Multi-sensor hybrid histidine kinase

SCOPe Domain Sequences for d6y7ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6y7ub_ d.110.3.0 (B:) automated matches {Chloroflexus aggregans [TaxId: 326427]}
asgmivtdagadqpivfvnrafstitgyapnevlgrnarflqgpqtdpatvarlreaiaa
arpiqerilnyrkdgqpfwnqlsispvrdetgnvvafvgvqtdvt

SCOPe Domain Coordinates for d6y7ub_:

Click to download the PDB-style file with coordinates for d6y7ub_.
(The format of our PDB-style files is described here.)

Timeline for d6y7ub_: