Lineage for d6xw6c1 (6xw6 C:6-126)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2745477Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries)
  8. 2745535Domain d6xw6c1: 6xw6 C:6-126 [384501]
    Other proteins in same PDB: d6xw6a1, d6xw6a2, d6xw6b1, d6xw6b2, d6xw6c2, d6xw6c3, d6xw6d2, d6xw6d3
    automated match to d5ocld_
    complexed with edo, mg

Details for d6xw6c1

PDB Entry: 6xw6 (more details), 1.96 Å

PDB Description: crystal structure of murine norovirus p domain in complex with nanobody nb-5853
PDB Compounds: (C:) Nanobody NB-5853

SCOPe Domain Sequences for d6xw6c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xw6c1 b.1.1.1 (C:6-126) automated matches {Vicugna pacos [TaxId: 30538]}
esggglvqagdslrvscaasgrtissspmgwfrqapgkerefvaaisgnggntyyldsvk
grfttsrdnakntvylqlnnlkpedtaiyycaarsrfsamhlayrrlvdyddwgqgtqvt
v

SCOPe Domain Coordinates for d6xw6c1:

Click to download the PDB-style file with coordinates for d6xw6c1.
(The format of our PDB-style files is described here.)

Timeline for d6xw6c1: