| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.299: Ns1 effector domain-like [143020] (1 superfamily) beta-X-beta(5)-alpha-beta-alpha; 2 layers: a/b; bifurcated beta-sheet; order 23654[1,7] |
Superfamily d.299.1: Ns1 effector domain-like [143021] (1 family) ![]() automatically mapped to Pfam PF00600 |
| Family d.299.1.1: Ns1 effector domain-like [143022] (2 proteins) C-terminal part of Pfam PF00600 |
| Protein automated matches [190936] (7 species) not a true protein |
| Species Influenza a virus (strain a/brevig mission/1/1918 h1n1) [TaxId:88776] [356001] (3 PDB entries) |
| Domain d6u28b_: 6u28 B: [384316] Other proteins in same PDB: d6u28d1, d6u28d2 automated match to d2gx9b_ |
PDB Entry: 6u28 (more details), 2.95 Å
SCOPe Domain Sequences for d6u28b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6u28b_ d.299.1.1 (B:) automated matches {Influenza a virus (strain a/brevig mission/1/1918 h1n1) [TaxId: 88776]}
asryltdmtleemsrdwfmlmpkqkvagslcirmdqaimdkniilkanfsvifdrletli
llrafteegaivgeisplpslpghtdedvknavgvliggleandntvrvsetlqrfawr
Timeline for d6u28b_: