SCOP 1.63: Domain d1yat__: 1yat -

Lineage for d1yat__ (1yat -)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (2 families)

5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (11 proteins)

6. Protein Calcineurin (FKBP12.6) [54539] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54542] (1 PDB entry)

8. Domain d1yat__: 1yat - [38427]
   complexed with fk5

Details for d1yat__

PDB Entry: 1yat, 2.5 Å

PDB Description: improved calcineurin inhibition by yeast fkbp12-drug complexes. crystallographic and functional analysis

SCOP Domain Sequences for d1yat__:

Sequence; same for both SEQRES and ATOM records:

>d1yat__ d.26.1.1 (-) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae)}
seviegnvkidrispgdgatfpktgdlvtihytgtlengqkfdssvdrgspfqcnigvgq
vikgwdvgipklsvgekarltipgpyaygprgfpglippnstlvfdvellkvn

Timeline for d1yat__:

• d1yat__ first appeared (with stable ids) in SCOP 1.55
  
• d1yat__ appears in SCOP 1.61
  
• d1yat__ appears in SCOP 1.65
  
• d1yat__ appears in the current release, SCOPe 2.08, called d1yata_